PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_00430
Common NameKK1_000445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB_related
Protein Properties Length: 340aa    MW: 37372 Da    PI: 9.6819
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_00430genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.12e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
    C.cajan_00430  94 PWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKY 138
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.11287143IPR017930Myb domain
SuperFamilySSF466894.71E-1788143IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-1990142IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-1191137IPR009057Homeodomain-like
SMARTSM007172.6E-1091141IPR001005SANT/Myb domain
CDDcd001675.20E-994139No hitNo description
PfamPF002496.2E-1194138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGSSGVKLFG VRLTDGSIIK KSASMGNLNH LHSLASSPNP  60
SSPSSDPPHD YLSDDPAHAS TFANRRAQRK KGVPWTEEEH RLFLIGLQKL GKGDWRGIAR  120
NFVVSRTPTQ VASHAQKYFI RQSHATRRKR RSSLFDMVPD VMHKSLYPPS VPEEQVLLPP  180
SENSQPSNGK SQPSLNLSLK SEFEPMETTS QENVEETNET MVGSNGLTPM APPFFPAYLP  240
VPFPMWPSTA ASFEEVKGGE TSHHQVHRPI PVIPKEPVNV DELVGMSHLS IGESQVRDRE  300
PSPLSLKLLG EPSRQSAFHA NTPVSGSELN RGKNSAIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150607.10.0hypothetical protein PHAVU_005G166300g
RefseqXP_007150608.10.0hypothetical protein PHAVU_005G166300g
TrEMBLA0A151SHD30.0A0A151SHD3_CAJCA; Myb-like protein J
STRINGGLYMA13G43120.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-97MYB_related family protein